Back to Top

American Science Labs
IGF1-LR3

label

Double click on above image to view full picture

Zoom Out
Zoom In

More Views

  • label

IGF1-LR3

Availability: In stock

$78.99

Availability: In stock

$78.99
Description

What is IGF1-LR3?


All the information below is strictly for research purposes only. Under no circumstance should this chemical be used for human consumption.


IGF1 LR3 (Long R3 Insulin-like Growth Factor) is a polypeptide hormone with properties similar to insulin. However, LR3 is a modified form of IGF1 to increase half-life and to prevent deactivation due to protein binding. IGF1 LR3 contains 83 amino acids with substitution of Arginine instead of Glutamic acid at position 3. Altered polypeptide sequence prevents protein binding and increases half-life. The biomolecule exert fat metabolizing properties in addition with transportation of glucose and amino acids into the cells to aid protein biosynthesis. Research evidences suggest that IGF1 LR3 promote muscle cell hyperplasia, increase neuro-functions and nitrogen retention in cells. The molecular weight and molecular mass of IGF1 LR3 is 9.200 and C990H1528N262O300S7, respectively.


IGF-1 LR3 allows many growth factors in the category of IGF’s to increase protein formation through nitrogen retention. The long version is more effective than the original IGF-1; it has an enhanced potency because of increased binding sites. The hormone is effective in accentuating hyperplasia, it is widely known for its activity in the splitting and formation of new muscle cells.  IGF-1 LR3 is a synthetic version of the natural insulin like growth factor but with modification at the position number 3, and an extension at the amino acid number 13 at the B-termini. It is more potent than insulin like growth factor 1. Moreover, research reveals that it has a longer half-life than IGF-1, the polypeptide plays a vital role in muscle renewal and it encourages the production and differential of stem cells. IGF-1LR3 is known to increase satellite activity of the cells, muscle protein content, muscle DNA, and muscle cross sectional area and muscle weight. The essence of the polypeptide lies in the fact that it induces muscles growth by enhancing hyperplasia.


IGF1-LR3 Chemical Profile


CAS: 946870-92-4
Formula: C990H1528N262O300S7
Molecular weight: 9200
Peptide purity: > 99.0%
Chain: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA






What is IGF1-LR3?



IGF1 LR3 (Long R3 Insulin-like Growth Factor) is a polypeptide hormone with properties similar to insulin. However, LR3 is a modified form of IGF1 to increase the half-life and to prevent deactivation due to protein binding. IGF1 LR3 contains 83 amino acids with the substitution of Arginine instead of Glutamic acid at position 3. Altered polypeptide sequence prevents protein binding and increases half-life. The biomolecules exert fat metabolizing properties in addition to transportation of glucose and amino acids into the cells to aid protein biosynthesis. Research evidence suggest that IGF1 LR3 promote muscle cell hyperplasia, increase neuro-functions, and nitrogen retention in cells. The molecular weight and molecular mass of IGF1 LR3 is 9.200 and C990H1528N262O300S7, respectively.



IGF-1 LR3 allows many growth factors in the category of IGF’s to increase protein formation through nitrogen retention. The long version is more effective than the original IGF-1; it has an enhanced potency because of increased binding sites. The hormone is effective in accentuating hyperplasia, it is widely known for its activity in the splitting and formation of new muscle cells. IGF-1 LR3 is a synthetic version of the natural insulin-like growth factor but with modification at the position number 3, and an extension at the amino acid number 13 at the B-termini. It is more potent than insulin-like growth factor 1. Moreover, research reveals that it has a longer half-life than IGF-1, the polypeptide plays a vital role in muscle renewal, and it encourages the production and differential of stem cells. IGF-1LR3 is known to increase satellite activity of the cells, muscle protein content, muscle DNA, and muscle cross-sectional area and muscle weight. The essence of the polypeptide lies in the fact that it induces muscles growth by enhancing hyperplasia.



Insulin-like growth factor 1 is a peptide hormone that is coded during transcription by IGF-1 gene. This is an essential gene because without it cell division, development, and repair cannot occur. Studies reveal that IGF-1 is located on the liver cells or hepatocytes. Growth hormone has a positive effect on the production of insulin-like growth factor 1 from hepatocytes. In a technical sense, the seventy amino acid peptide is vital in accentuating production of new cells and this is vital for tissue repair. As indicated earlier insulin-like growth factor 1 is composed of seventy amino acids and these amino acids are linked via disulfide bridges. The molecular configuration of the peptide is similar to that of insulin and research shows that it has anabolic effects on the body. This peptide is utilized in paracrine and autocrine signaling cascades to initiate molecular interactions and which in turn targets receptors and tissues. Findings from various researches indicate that it has the ability to induce sulfation and this will not affect levels of insulin-like growth factor 1. Understanding how insulin-like growth factor 1 works is important in presenting the peptide in the right configuration and it will aid you in understanding how it exerts functionality.




Research shows that insulin-like growth factor 1 is vital in accentuating production of growth hormone from the pituitary gland and it is essential in promoting metabolism as it increases sensitization of insulin receptors. When insulin receptors are sensitized, they increase the response of the peptide to growth hormone and other factors. In addition, research shows that fat catabolism is enhanced with an administration of the peptide. Catabolism of fats refers to a process where destructive and excess fats stored in visceral and peripheral organs are broken downs for excretion or for uses in energy production. Once energy is released, it enhances the functionality of body systems from cells, tissues, and organs. Moreover, studies reveal that the peptide is essential in promoting lean muscles by accentuating myoblastic differentiation and working mechanism.



IGF-1 LR 3 has abilities to increase protein synthesis, this is a crucial aspect in any research, and when coupled with lean body mass it is important in increasing multiplication of myocytes. Myocytes multiplication is important because it helps in reducing chances of muscle atrophy or hypertrophy that is characterized by enlargement of muscle cells. In some situations when these muscles enlarge it becomes uncontrolled and it damages the cells causing rupturing. The total amount of fat in the system depends on the presence of insulin-like growth factor 1 on the system. Differential research studies show that receptors for this peptide are classified under tyrosine kinase family receptors. It is vital to note that the binding of the ligand is crucial in activating intracellular Akt signaling pathway and other downstream effects, which include cellular death or apoptosis. In addition, it is effective in accentuating proliferation, cell division, cell development, and maturity. Cell differentiation and maturity is an essential aspect because without it growth and development will not occur.



Recent studies reveal that IGF-1 LR3 is functional in mediating growth hormone activities and during puberty the hormone is produced at, it’s highest. It plays a vital role in promoting growth and development of cell, tissues, and organs. Lack of production or production of low amounts of IGF -1 LR3 leads to stunted growth or diminished stature. There are various models used in research and IGF is the best peptide in accentuating growth and development according to a recent research study. In some cases, researchers have used it in combination with other therapies to stimulate the production of growth hormone and this presents a good avenue for research and development. Research shows that insulin-like growth factor 1 is vital in enhancing nucleotide synthesis and increasing neuronal growth. Moreover, therapeutics shows that a combined version of this peptide is essential in combating various ailments including peripheral neuropathies a condition that leads to degeneration of motor axons.



Research shows that insulin-like growth factor 1 is vital in understanding the similarities between naturally produced IGF-1 and the exogenous hormone. Documented research shows that IGF-1 LR 3 has up-regulatory effects on increasing amino acid production and transport of glucose to different cells in the body and this is via inhibiting protein degradation while accentuating ribonucleic acid synthesis. In essence, the total amount of protein cells in a system is enhanced by a large margin. In addition, hypertrophy is a concept where cells multiply rapidly causing metastasis among other complex cellular division. Administration of insulin-like growth factor 1 is seen to reduce the effects of cellular hypertrophy and that it could aid in a regulated cell division.



There have been numerous studies aimed at preventing cellular degradation and one of the common methods is the administration of insulin-like growth factor 1. Current research is mostly focused on producing peptides that can survive in a biological system for long without undergoing any wear and tear. In addition, it is able to exert its effects half-life of insulin-like growth factor 1 is less than fourteen minutes and the synthetic version is about 24-30 hours. An increase in half-life means that bioavailability of the peptide is not altered even when peptide distribution continues. The main area of worry in peptide research is bioavailability; in most cases, peptides undergo degradation where cellular enzymes such as proteases, lyase among others degrade the enzymes. Recent studies show that the peptide has effects on metabolism and according to research, it enhances metabolism, therefore, weight loss occurs. The main aim of the research was to understand how synthetic insulin-like growth factor works in enhancing weight loss.



Heifers were subjected to the peptide and were underfed intentionally for them to lose weight. After numerous weeks the heifers lost weight and they were categorized into two to allow researchers to make findings on different aspects. Insulin-like growth factor 1 was then administered intravenously and after a considerable amount of time, the test group showed no effect in skeletal and muscle protein in addition it showed an increased amino acid and plasma concentration. Placebo maintained a regular concentration of the insulin-like growth factor 2. It is imperative to note that insulin-like growth factor 1 contributed to increased protein retention and the binding proteins elicited a better protein production. There have been various researches geared towards identifying a role of insulin-like growth factor 1 in the stabilization of atherosclerosis and this is through alteration of smooth muscle type phenotype. In the research mice used in test subjects were administered with insulin-like growth factor 1, they were macrophage conditioned and M1 polarized. The negative feedback signaling system in preventing atherosclerosis is a key area of interact.



According to the study, there was an up-regulation of insulin-like growth factor 1 binding protein 3 and it resulted in ablation of various tissues. In addition, the research media had inhibitory effects on col 3 al and actin genes, however, matrix-degrading enzymes were up-regulated in this research media. Results from the study indicate that insulin-like growth factor 1 LR3 has a net positive effect in preventing atherosclerotic plaque.



Recommended dosage cycles



The recommended dosage cycle is 20-60 mg per day depending on the test subject. It is important that you lay down the objective of your research and understand what you expect before embarking on any research. Moreover, administration of this peptide should occur in fifty days continuously and for any effect to be seen peptide administration should be regular. However, peptides supplied in the market are for research purposes only and human consumption is not allowed. It is vital that you choose a reputable vendor to supply you with peptide for research because peptide quality and purity play a key role in research and development.


 

You may also be interested in the following product(s)

 

IGF1 DES

IGF1 DES

$84.99